Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polynucleobacter necessarius ATP synthase subunit b (atpF)

This Recombinant Polynucleobacter necessarius ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B1XSD0

Expression Region

1-156

Origin

Polynucleobacter necessarius (strain STIR1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNEAEQELNKARQEGVQRVAEAEKRAQMSAEEIRANAQAEAARVISQAQQDAAQQVTRAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant STAT2 Antibody
RC-16667-01 50 μL

Recombinant STAT2 Antibody

Sign In for Pricing
View Details
Recombinant STAT2 Antibody
RC-16667-02 100 µL

Recombinant STAT2 Antibody

Sign In for Pricing
View Details
Recombinant STAT2 Antibody
RC-16667-03 1 mL

Recombinant STAT2 Antibody

Sign In for Pricing
View Details
11-Oxo Androsterone
TRC-O847110-5MG 5 mg

11-Oxo Androsterone

Sign In for Pricing
View Details
Recombinant Human NBL1 Protein (Fc Tag)
PDMH100301-01 20 µg

Recombinant Human NBL1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human NBL1 Protein (Fc Tag)
PDMH100301-02 100 µg

Recombinant Human NBL1 Protein (Fc Tag)

Sign In for Pricing
View Details