Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit b (atpF)

This Recombinant Clostridium botulinum ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-159.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B2TJZ6

Expression Region

1-159

Origin

Clostridium botulinum (strain Eklund 17B / Type B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METNYSVIFMTIINFCILVAILKHFFWDKIKGIINERQDFVDEQLLKVDEDSEKARMYLLENQRILQTAKEEGKKITESQKEKANKVYDEIVEDANEEAKSLLERAKTDIQREKEKAEYEIKKQAVDLAIELSIKALEENIDESKHRELISNFITKVGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MagSi-DX Blood
MDDX00020960 10x 96 Preparations

MagSi-DX Blood

Sign In for Pricing
View Details
Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit
MBS9391553-01 48 Well

Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit

Sign In for Pricing
View Details
Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit
MBS9391553-02 96 Well

Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit

Sign In for Pricing
View Details
Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit
MBS9391553-03 5x 96 Well

Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit

Sign In for Pricing
View Details
Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit
MBS9391553-04 10x 96 Well

Rat Lymphocyte Antigen 6E (LY6E) ELISA Kit

Sign In for Pricing
View Details
TDT, NT (DNTT, TDT, DNA nucleotidylexotransferase, Terminal addition enzyme, Terminal deoxynucleotidyltransferase) (AP)
MBS6354667-01 0.2 mL

TDT, NT (DNTT, TDT, DNA nucleotidylexotransferase, Terminal addition enzyme, Terminal deoxynucleotidyltransferase) (AP)

Sign In for Pricing
View Details