Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M5 ATP synthase subunit b (atpF)

This Recombinant Streptococcus pyogenes serotype M5 ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A2RFC6

Expression Region

1-164

Origin

Streptococcus pyogenes serotype M5 (strain Manfredo)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLETKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-Methoxy-2-methylphenyl) -1-propanone
OR1098268 1 Each

1- (4-Methoxy-2-methylphenyl) -1-propanone

Sign In for Pricing
View Details
VWF Antibody
orb1317804-01 30 µL

VWF Antibody

Sign In for Pricing
View Details
VWF Antibody
orb1317804-02 50 μL

VWF Antibody

Sign In for Pricing
View Details
VWF Antibody
orb1317804-03 100 µL

VWF Antibody

Sign In for Pricing
View Details
PLK5 Antibody (Center)
E45R04972G-1 100 µL

PLK5 Antibody (Center)

Sign In for Pricing
View Details
PDCD2 Protein Vector (Rat) (pPM-C-HA)
36261026 500 ng

PDCD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details