Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M49 ATP synthase subunit b (atpF)

This Recombinant Streptococcus pyogenes serotype M49 ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B5XKP7

Expression Region

1-164

Origin

Streptococcus pyogenes serotype M49 (strain NZ131)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSITFGELVGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSDLMVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDKRB1 Antibody
8G216-AAT 50 µg

BDKRB1 Antibody

Sign In for Pricing
View Details
Fluoresceinamine, Isomer 1
TRC-F485300-500MG 500 mg

Fluoresceinamine, Isomer 1

Sign In for Pricing
View Details
HRP2 (HDGFRP2) (NM_032631) Human Recombinant Protein
TP318644M 100 µg

HRP2 (HDGFRP2) (NM_032631) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS801911 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC942562-100 1x 100 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Chil1 activation kit by CRISPRa
GA200717 1 Kit

Mouse Chil1 activation kit by CRISPRa

Sign In for Pricing
View Details