Recombinant Dog Translocon-associated protein subunit beta (SSR2)
This Recombinant Dog Translocon-associated protein subunit beta (SSR2) spans the amino acid sequence from region 18-183.
Product Specifications
Product Name Alternative
Translocon-associated protein subunit beta, TRAP-beta, Glycoprotein 25H, gp25H, Signal sequence receptor subunit beta, SSR-beta
UniProt
P23438
Expression Region
18-183
Origin
Canis familiaris (Dog) (Canis lupus familiaris)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVTYLAQEDGPVVIGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKSKKN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740252-100 1x 100 µL
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB3799-100 1x 100 µL
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (rKRT6A/2100), 0.2mg/mL
Sign In for Pricing
View Details 
BNC041747-100 1x 100 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
