Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis ATP synthase subunit b (atpF)

This Recombinant Bacillus thuringiensis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A0RL99

Expression Region

1-168

Origin

Bacillus thuringiensis (strain Al Hakam)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLLGAAIPFGTIAYTLFIFLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEVGEAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transglutaminase 4 (TGM4) Human Gene Knockout Kit (CRISPR)
KN402705 1 Kit

Transglutaminase 4 (TGM4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATOH1 Human Gene Knockout Kit (CRISPR)
KN210192LP 1 Kit

ATOH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105H-01 50 Tests

PE/Cyanine7 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105H-02 100 Tests

PE/Cyanine7 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105H-03 2x 100 Tests

PE/Cyanine7 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
EP300 Antibody
KC-8441-01 50 μL

EP300 Antibody

Sign In for Pricing
View Details