Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit b (atpF)

This Recombinant Bacillus cereus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B7HFK6

Expression Region

1-168

Origin

Bacillus cereus (strain B4264)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLLGASIPFGTIAYTLFIFLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEVGEAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR562391 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Syde1 Mouse Gene Knockout Kit (CRISPR)
KN517042 1 Kit

Syde1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Ileum
CR561379 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
EIF5AL1 (NM_001099692) Human Over-expression Lysate
LC420500 20 µg

EIF5AL1 (NM_001099692) Human Over-expression Lysate

Sign In for Pricing
View Details
D Box Binding Protein (DBP) Human Gene Knockout Kit (CRISPR)
KN402051 1 Kit

D Box Binding Protein (DBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UNC45B (NM_173167) Human Recombinant Protein
TP323751 20 µg

UNC45B (NM_173167) Human Recombinant Protein

Sign In for Pricing
View Details