Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus ATP synthase subunit b (atpF)

This Recombinant Bacillus cereus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

B7JGN4

Expression Region

1-168

Origin

Bacillus cereus (strain AH820)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLLLGAAIPFGTIAYTLFIFLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIASKVIEKELKEEDQVKLIRDYIKEVGEAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1 Mouse Monoclonal Antibody [Clone ID: G168-728]
AM10114SU-N 1 mL

MLH1 Mouse Monoclonal Antibody [Clone ID: G168-728]

Sign In for Pricing
View Details
SQSTM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]
TA502131BM 100 µL

SQSTM1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]

Sign In for Pricing
View Details
RYK Antibody
OC-2526-01 50 μL

RYK Antibody

Sign In for Pricing
View Details
RYK Antibody
OC-2526-02 100 µL

RYK Antibody

Sign In for Pricing
View Details
RYK Antibody
OC-2526-03 1 mL

RYK Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS711806 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details