Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitratiruptor sp. ATP synthase subunit b (atpF)

This Recombinant Nitratiruptor sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A6Q4C4

Expression Region

1-172

Origin

Nitratiruptor sp. (strain SB155-2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQKLLMLLLLGSVSLFANEAAASGGTDIIPRTVNFLIFAAILYYLAAEPIKRFFQERKEGIAKRLEEVEAKLKEAKEEKAQAEAELKKAKELAQEIVETAKQEIEILTKEIKEQAKQEIEMLEKSFEESMELEKRKRVRAITKEVLEELFEEKALELEKEKFVNLIVKKVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salinomycin-BSA conjugate
50568-AAT 1 mg

Salinomycin-BSA conjugate

Sign In for Pricing
View Details
Primer Panel
HPP6004A 3x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
tert-Dodecanethiol
TRC-T204763-500MG 500 mg

tert-Dodecanethiol

Sign In for Pricing
View Details
Melengestrol
TRC-M215340-2.5MG 2.5 mg

Melengestrol

Sign In for Pricing
View Details
CD4 Recombinant Rabbit Monoclonal Antibody [ST0488]
ET1609-52 100 µL

CD4 Recombinant Rabbit Monoclonal Antibody [ST0488]

Sign In for Pricing
View Details
RPS9 Rabbit Polyclonal Antibody
TA368689 100 µL

RPS9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details