Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitratiruptor sp. ATP synthase subunit b (atpF)

This Recombinant Nitratiruptor sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A6Q4C4

Expression Region

1-172

Origin

Nitratiruptor sp. (strain SB155-2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQKLLMLLLLGSVSLFANEAAASGGTDIIPRTVNFLIFAAILYYLAAEPIKRFFQERKEGIAKRLEEVEAKLKEAKEEKAQAEAELKKAKELAQEIVETAKQEIEILTKEIKEQAKQEIEMLEKSFEESMELEKRKRVRAITKEVLEELFEEKALELEKEKFVNLIVKKVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF405S conjugate, 0.1mg/mL
BNC041648-100 1x 100 µL

TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SETD1B Human Gene Knockout Kit (CRISPR)
KN427091 1 Kit

SETD1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF740 conjugate, 0.1mg/mL
BNC742337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROCK2 Human Gene Knockout Kit (CRISPR)
KN417764 1 Kit

ROCK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD81 Recombinant Rabbit monoclonal Antibody
HA723193 100 µL

CD81 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Phloroglucinol Glucuronide Sodium Salt
TRC-P340015-2.5MG 2.5 mg

Phloroglucinol Glucuronide Sodium Salt

Sign In for Pricing
View Details