Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Syndecan-4 (Sdc4)

This Recombinant Mouse Syndecan-4 (Sdc4) spans the amino acid sequence from region 24-198.

Product Specifications

Product Name Alternative

Syndecan-4, SYND4, Ryudocan core protein

UniProt

O35988

Expression Region

24-198

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS638383 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
CHRM2 (NM_001006632) Human Over-expression Lysate
LC423530 20 µg

CHRM2 (NM_001006632) Human Over-expression Lysate

Sign In for Pricing
View Details
AMDHD2 Polyclonal Antibody
E-AB-14556-01 20 µL

AMDHD2 Polyclonal Antibody

Sign In for Pricing
View Details
AMDHD2 Polyclonal Antibody
E-AB-14556-02 60 µL

AMDHD2 Polyclonal Antibody

Sign In for Pricing
View Details
AMDHD2 Polyclonal Antibody
E-AB-14556-03 120 µL

AMDHD2 Polyclonal Antibody

Sign In for Pricing
View Details
AMDHD2 Polyclonal Antibody
E-AB-14556-04 200 µL

AMDHD2 Polyclonal Antibody

Sign In for Pricing
View Details