Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD83 antigen (Cd83)

This Recombinant Mouse CD83 antigen (Cd83) spans the amino acid sequence from region 22-196.

Product Specifications

Product Name Alternative

CD83 antigen, mCD83, CD_antigen= CD83

UniProt

O88324

Expression Region

22-196

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium persulfate
GK5993-1kg 1 Kg

Sodium persulfate

Sign In for Pricing
View Details
Arginase 1 Rabbit Polyclonal Antibody (PE)
orb490888 100 µL

Arginase 1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
KIAA0999 Blocking Peptide
33R-5007 0.1 mg

KIAA0999 Blocking Peptide

Sign In for Pricing
View Details
S100 alpha 6 (S100A6) Human Recombinant Protein
TP726396 50 µg

S100 alpha 6 (S100A6) Human Recombinant Protein

Sign In for Pricing
View Details
PDE6D Rabbit pAb
E45R21312N 50 ul

PDE6D Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal GCC1 Antibody
NBP1-83610 0.1 mL

Rabbit Polyclonal GCC1 Antibody

Sign In for Pricing
View Details