Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD83 antigen (Cd83)

This Recombinant Mouse CD83 antigen (Cd83) spans the amino acid sequence from region 22-196.

Product Specifications

Product Name Alternative

CD83 antigen, mCD83, CD_antigen= CD83

UniProt

O88324

Expression Region

22-196

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Latrophilin-1 (LPHN1) , partial
MBS1123330-01 0.05 mg (E-Coli)

Recombinant Human Latrophilin-1 (LPHN1) , partial

Sign In for Pricing
View Details
Recombinant Human Latrophilin-1 (LPHN1) , partial
MBS1123330-02 0.05 mg (Yeast)

Recombinant Human Latrophilin-1 (LPHN1) , partial

Sign In for Pricing
View Details
Recombinant Human Latrophilin-1 (LPHN1) , partial
MBS1123330-03 0.05 mg (Baculovirus)

Recombinant Human Latrophilin-1 (LPHN1) , partial

Sign In for Pricing
View Details
Recombinant Human Latrophilin-1 (LPHN1) , partial
MBS1123330-04 0.2 mg (E-Coli)

Recombinant Human Latrophilin-1 (LPHN1) , partial

Sign In for Pricing
View Details
Recombinant Human Latrophilin-1 (LPHN1) , partial
MBS1123330-05 0.5 mg (E-Coli)

Recombinant Human Latrophilin-1 (LPHN1) , partial

Sign In for Pricing
View Details
Recombinant Human Latrophilin-1 (LPHN1) , partial
MBS1123330-06 0.2 mg (Yeast)

Recombinant Human Latrophilin-1 (LPHN1) , partial

Sign In for Pricing
View Details