Recombinant Mouse Natural killer cells antigen CD94 (Klrd1)
This Recombinant Mouse Natural killer cells antigen CD94 (Klrd1) spans the amino acid sequence from region 1-179.
Product Specifications
Product Name Alternative
Natural killer cells antigen CD94, Killer cell lectin-like receptor subfamily D member 1, CD_antigen= CD94
UniProt
O54707
Expression Region
1-179
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
IRBAHUS100A13AAP326120UL 1 Each
Rabbit Anti Human S100A13 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (Western Blot,ELISA)
Sign In for Pricing
View Details 
OKAG01606-2X96W 2x 96 Well Plates
OKAG01606-2X96W - Phospho-JNK1/2/3 (Thr183+Tyr185) Colorimetric Cell-Based ELISA Kit
Sign In for Pricing
View Details 