Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Syndecan-2 (Sdc2)

This Recombinant Mouse Syndecan-2 (Sdc2) spans the amino acid sequence from region 19-202.

Product Specifications

Product Name Alternative

Syndecan-2, SYND2, Fibroglycan, Heparan sulfate proteoglycan core protein, HSPG, CD_antigen= CD362

UniProt

P43407

Expression Region

19-202

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)
MBS1469975-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)
MBS1469975-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)
MBS1469975-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)
MBS1469975-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)
MBS1469975-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)
MBS1469975-06 1 mg (E-Coli)

Recombinant Arabidopsis thaliana Costars family protein At4g33640 (At4g33640)

Sign In for Pricing
View Details