Recombinant Rat Proheparin-binding EGF-like growth factor (Hbegf)
This Recombinant Rat Proheparin-binding EGF-like growth factor (Hbegf) spans the amino acid sequence from region 24-208.
Product Specifications
Product Name Alternative
Proheparin-binding EGF-like growth factor, Cleaved into the following chain:, 1. Heparin-binding EGF-like growth factor, 2. HB-EGF, 3. HBEGF
UniProt
Q06175
Expression Region
24-208
Origin
Rattus norvegicus (Rat)
Field of Research
Cancer Biology; Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDLEGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELRIPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGMASSH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP52467PU-N 400 µL
Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details