Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein A33 (A33R)

This Recombinant Vaccinia virus Protein A33 (A33R) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

Protein A33

UniProt

P68616

Expression Region

1-185

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUS Polyclonal Antibody, HRP Conjugated
A51450-100 100 µL

FUS Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mouse Apolipoprotein M, Apo-M ELISA Kit
MBS160756-01 48 Well

Mouse Apolipoprotein M, Apo-M ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein M, Apo-M ELISA Kit
MBS160756-02 96 Well

Mouse Apolipoprotein M, Apo-M ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein M, Apo-M ELISA Kit
MBS160756-03 5x 96 Well

Mouse Apolipoprotein M, Apo-M ELISA Kit

Sign In for Pricing
View Details
Mouse Apolipoprotein M, Apo-M ELISA Kit
MBS160756-04 10x 96 Well

Mouse Apolipoprotein M, Apo-M ELISA Kit

Sign In for Pricing
View Details
Human Desmoglein-3 (DSG-3) ELISA Kit
MBS3801168-01 48 Well

Human Desmoglein-3 (DSG-3) ELISA Kit

Sign In for Pricing
View Details