Recombinant Human CD83 antigen (CD83)
This Recombinant Human CD83 antigen (CD83) spans the amino acid sequence from region 20-205.
Product Specifications
Product Name Alternative
CD83 antigen, hCD83, B-cell activation protein, Cell surface protein HB15, CD_antigen= CD83
UniProt
Q01151
Expression Region
20-205
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038831-HRP 200 µL
NCKAP1, ID (NCKAP1, HEM2, KIAA0587, NAP1, Nck-associated protein 1, Membrane-associated protein HEM-2, p125Nap1) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
I8434-01K 100 Tests
Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor (TcMF), Cytotoxic Lymphocyte Maturation Factor 35kD Subunit, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (PerCP)
Sign In for Pricing
View Details HV083117-01 1 Each
Anti-Human IL28B/IL28C/IFNL3 Antibody (SAA0394), FITC
Sign In for Pricing
View Details