Recombinant Human CD83 antigen (CD83)
This Recombinant Human CD83 antigen (CD83) spans the amino acid sequence from region 20-205.
Product Specifications
Product Name Alternative
CD83 antigen, hCD83, B-cell activation protein, Cell surface protein HB15, CD_antigen= CD83
UniProt
Q01151
Expression Region
20-205
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P1001-32L5-HRP 100 µL
P53, Mutant (Tumor Suppressor Protein 53, Cellular Tumor Antigen p53, Phosphoprotein p53, Antigen NY-CO-13, TP53) (HRP) discontinued
Sign In for Pricing
View Details 
