Recombinant Rat Sodium channel subunit beta-2 (Scn2b)
This Recombinant Rat Sodium channel subunit beta-2 (Scn2b) spans the amino acid sequence from region 30-215.
Product Specifications
Product Name Alternative
Sodium channel subunit beta-2
UniProt
P54900
Expression Region
30-215
Origin
Rattus norvegicus (Rat)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEVTVPTTLSVLNGSDTRLPCTFNSCYTVNHKQFSLNWTYQECSNCSEEMFLQFRMKIINLKLERFGDRVEFSGNPSKYDVSVTLKNVQLEDEGIYNCYITNPPDRHRGHGKIYLQVLLEVPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNAEDGAK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6308318-01 0.1 mL
HRAS, CT (HRAS, HRAS1, GTPase HRas, H-Ras-1, Ha-Ras, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (MaxLight 750)
Sign In for Pricing
View Details MBS6308318-02 5x 0.1 mL
HRAS, CT (HRAS, HRAS1, GTPase HRas, H-Ras-1, Ha-Ras, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (MaxLight 750)
Sign In for Pricing
View Details MBS6283306-01 0.2 mL
CD49e, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (HRP)
Sign In for Pricing
View Details MBS6283306-02 5x 0.2 mL
CD49e, CT (ITGA5, FNRA, Integrin alpha-5, CD49 antigen-like family member E, Fibronectin receptor subunit alpha, Integrin alpha-F, VLA-5, CD49e, Integrin alpha-5 heavy chain, Integrin alpha-5 light chain) (HRP)
Sign In for Pricing
View Details