Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 11D (TMPRSS11D)

This Recombinant Human Transmembrane protease serine 11D (TMPRSS11D) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Transmembrane protease serine 11D, EC= 3.4.21.-, Airway trypsin-like protease, Cleaved into the following 2 chains:, 1. Transmembrane protease serine 11D non-catalytic chain, 2. Transmembrane protease serine 11D catalytic chain

UniProt

O60235

Expression Region

1-186

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFYRSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRAHVAKLRQDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI4E2]
CF810518 100 µg

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI4E2]

Sign In for Pricing
View Details
SLC39A12 (NM_001145195) Human Over-expression Lysate
LC428745 20 µg

SLC39A12 (NM_001145195) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
Connexin 43 Recombinant Rabbit Monoclonal Antibody [PSH0-32]
HA721312 100 µL

Connexin 43 Recombinant Rabbit Monoclonal Antibody [PSH0-32]

Sign In for Pricing
View Details