Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell antigen CD7 (Cd7)

This Recombinant Mouse T-cell antigen CD7 (Cd7) spans the amino acid sequence from region 24-210.

Product Specifications

Product Name Alternative

T-cell antigen CD7, CD_antigen= CD7

UniProt

P50283

Expression Region

24-210

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPAAIAVGFFFTGLLLGVVCSMLRKIQIKKLCASGIKESPCVVYEDMSYSNRKTPCIPNQYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC6B siRNA (Mouse)
orb1839732-01 15 nmol

EXOC6B siRNA (Mouse)

Sign In for Pricing
View Details
EXOC6B siRNA (Mouse)
orb1839732-02 30 nmol

EXOC6B siRNA (Mouse)

Sign In for Pricing
View Details
mmu-miR-30a-3p miRNA Mimic
MBS8300643-01 5 nmol

mmu-miR-30a-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-30a-3p miRNA Mimic
MBS8300643-02 10 nmol

mmu-miR-30a-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-30a-3p miRNA Mimic
MBS8300643-03 5x 10 nmol

mmu-miR-30a-3p miRNA Mimic

Sign In for Pricing
View Details
C-KIT/CD117 Protein (N-His-GST, Human)
P514351 100 µg

C-KIT/CD117 Protein (N-His-GST, Human)

Sign In for Pricing
View Details