Recombinant Human T-cell surface glycoprotein CD8 beta chain (CD8B)
This Recombinant Human T-cell surface glycoprotein CD8 beta chain (CD8B) spans the amino acid sequence from region 22-210.
Product Specifications
Product Name Alternative
T-cell surface glycoprotein CD8 beta chain, CD_antigen= CD8b
UniProt
P10966
Expression Region
22-210
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA750965 100 µL
CSNK1A1 + CSNK1A1L Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
