Recombinant Mouse Membrane-associated progesterone receptor component 1 (Pgrmc1)
This Recombinant Mouse Membrane-associated progesterone receptor component 1 (Pgrmc1) spans the amino acid sequence from region 2-195.
Product Specifications
Product Name Alternative
Membrane-associated progesterone receptor component 1
UniProt
O55022
Expression Region
2-195
Origin
Mus musculus (Mouse)
Field of Research
Pharmacology & Drug Discovery; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
AAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882897-500 1x 500 µL
Major Vault Protein (MVP) (VP2897R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 