Recombinant Rabbit T-cell-specific surface glycoprotein CD28 (CD28)
This Recombinant Rabbit T-cell-specific surface glycoprotein CD28 (CD28) spans the amino acid sequence from region 20-221.
Product Specifications
Product Name Alternative
T-cell-specific surface glycoprotein CD28, CD_antigen= CD28
UniProt
P42069
Expression Region
20-221
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
NKILVKQSPMLVVNNNEVNLSCKYTYNLFSKEFRASLYKGADSAVEVCVVNGNFSHPHQFHSTTGFNCDGKLGNETVTFYLKNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKEQHFCPAHPSPKSSTLFWVLVVVGAVLAFYSMLVTVALFSCWMKSKKNRLLQSDYMNMTPRRPGPTRKHYQPYAPARDFAAYRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126422-HRP 100 µL
ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) (HRP)
Sign In for Pricing
View Details 