Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain (Cd79b)

This Recombinant Mouse B-cell antigen receptor complex-associated protein beta chain (Cd79b) spans the amino acid sequence from region 26-228.

Product Specifications

Product Name Alternative

B-cell antigen receptor complex-associated protein beta chain, B-cell-specific glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 protein, CD_antigen= CD79b

UniProt

P15530

Expression Region

26-228

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H4]
TA504057BM 100 µL

SIX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
Human anti-IgE receptor antibody ELISA KIT
JOT-EKD0012Hu 96 wells

Human anti-IgE receptor antibody ELISA KIT

Sign In for Pricing
View Details
Nicotine Tartrate Dihydrate
24303-84 10 g

Nicotine Tartrate Dihydrate

Sign In for Pricing
View Details
5a Antibody
MBS9012191 Inquire

5a Antibody

Sign In for Pricing
View Details
GCN2 (Phospho Thr899) (5U3) Rabbit Monoclonal Antibody
E28G2350 100 µL

GCN2 (Phospho Thr899) (5U3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TSPYL4 (NM_021648) Human Over-expression Lysate
E45H11515-2 20 µg

TSPYL4 (NM_021648) Human Over-expression Lysate

Sign In for Pricing
View Details