What is the catalog number for Recombinant Mouse CMRF35-like molecule 6 (Cd300c)?

The catalog number for Recombinant Mouse CMRF35-like molecule 6 (Cd300c) is orb2902894.

What sizes are available for Recombinant Mouse CMRF35-like molecule 6 (Cd300c)?

Recombinant Mouse CMRF35-like molecule 6 (Cd300c) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Mouse CMRF35-like molecule 6 (Cd300c) come in?

Recombinant Mouse CMRF35-like molecule 6 (Cd300c) is available in 2 different pack sizes.

Is Recombinant Mouse CMRF35-like molecule 6 (Cd300c) in stock?

Recombinant Mouse CMRF35-like molecule 6 (Cd300c) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Mouse CMRF35-like molecule 6 (Cd300c)

This Recombinant Mouse CMRF35-like molecule 6 (Cd300c) spans the amino acid sequence from region 22-229.

Product Specifications

Product Name Alternative

CMRF35-like molecule 6, CLM-6, CD300 antigen-like family member C, CD_antigen= CD300c

UniProt

A2A7V7

Expression Region

22-229

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPHFWILVSLKLPLFLSMLGALLWVNRPQRCSGGSSAWPCYENQ