Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine CD302 antigen (CD302)

This Recombinant Bovine CD302 antigen (CD302) spans the amino acid sequence from region 23-232.

Product Specifications

Product Name Alternative

CD302 antigen, Type I transmembrane C-type lectin receptor DCL-1

UniProt

A8WH74

Expression Region

23-232

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DCPSSTWVQFQDSCYIFLQEAIKVESIEDVRNQCTNHGADMISIHNEEENAFILDTLKKQWKDPADILLGMFFDTDDASFKWFDNSNMTFNKWSDQEDDEELVDTCAFLHTKTGDWKKGNCEVSSVEGTLCKAAIPYEKKYLSDNRILISALVIASTVILTVLGAVVWFLYKRSLDSGFTTVFSAAHQSPYNDDCVLVVAEENEYDIQFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFN2 AAV Vector (Human) (CMV)
36451101 1 µg

PFN2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
HTR3B Antibody
E10-31296 100 µL

HTR3B Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SMPD1 Antibody
NBP2-22365-100uL 100 µL

Rabbit Polyclonal SMPD1 Antibody

Sign In for Pricing
View Details
MouseMMP1 (MatrixMetalloproteinase1) ELISAKit
ELK2543-01 48 Tests

MouseMMP1 (MatrixMetalloproteinase1) ELISAKit

Sign In for Pricing
View Details
MouseMMP1 (MatrixMetalloproteinase1) ELISAKit
ELK2543-02 96 Tests

MouseMMP1 (MatrixMetalloproteinase1) ELISAKit

Sign In for Pricing
View Details
YWHAQ Antibody
MBS9607669-01 0.1 mL

YWHAQ Antibody

Sign In for Pricing
View Details