Recombinant Trichosurus vulpecula CD302 antigen (CD302)
This Recombinant Trichosurus vulpecula CD302 antigen (CD302) spans the amino acid sequence from region 22-231.
Product Specifications
Product Name Alternative
CD302 antigen, Type I transmembrane C-type lectin receptor DCL-1
UniProt
A8WH72
Expression Region
22-231
Origin
Trichosurus vulpecula (Brush-tailed possum)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
DCPSSSWVQFQSNCYIFLQTTVKIENIEDVRNQCTDSASGADMISIHNEEENAFILETFKKRWKAQDDILLGMFYDTDDESFKWYDKSNMTFNKWKNSEESQDLIDTCGFLQPKSGIWKKGNCEVSSVEGALCKAAVSYEKKYLPDHHILITALVIASTTILTITGAVVWFLYKRNLTSGLTNTAYTTAPQLPYNDDCILVDAEENEYVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
