Recombinant Mouse Myelin protein P0 (Mpz)
This Recombinant Mouse Myelin protein P0 (Mpz) spans the amino acid sequence from region 30-248.
Product Specifications
Product Name Alternative
Myelin protein P0, Myelin peripheral protein, MPP, Myelin protein zero
UniProt
P27573
Expression Region
30-248
Origin
Mus musculus (Mouse)
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
IVVYTDREIYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGAFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIRYCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGLGESRKDKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6444602-01 0.1 mL
CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (Biotin)
Sign In for Pricing
View Details MBS6444602-02 5x 0.1 mL
CCR5, NT (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (Biotin)
Sign In for Pricing
View Details