Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kunitz-type protease inhibitor 2 (SPINT2)

This Recombinant Human Kunitz-type protease inhibitor 2 (SPINT2) spans the amino acid sequence from region 28-252.

Product Specifications

Product Name Alternative

Kunitz-type protease inhibitor 2, Hepatocyte growth factor activator inhibitor type 2, HAI-2, Placental bikunin

UniProt

O43291

Expression Region

28-252

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant EGF (Epidermal growth factor) protein, AF
PROTP01133-5-1mg 1 mg

Human recombinant EGF (Epidermal growth factor) protein, AF

Sign In for Pricing
View Details
KLK15 sgRNA CRISPR Lentivector (Human) (Target 2)
K1160903 1.0 µg DNA

KLK15 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
BOLA3 Antibody, FITC conjugated
MBS7050379-01 0.05 mg

BOLA3 Antibody, FITC conjugated

Sign In for Pricing
View Details
BOLA3 Antibody, FITC conjugated
MBS7050379-02 0.1 mg

BOLA3 Antibody, FITC conjugated

Sign In for Pricing
View Details
BOLA3 Antibody, FITC conjugated
MBS7050379-03 5x 0.1 mg

BOLA3 Antibody, FITC conjugated

Sign In for Pricing
View Details
XPO4 Protein (N-His, Human)
P509707 100 µg

XPO4 Protein (N-His, Human)

Sign In for Pricing
View Details