Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD27 antigen (Cd27)

This Recombinant Mouse CD27 antigen (Cd27) spans the amino acid sequence from region 24-250.

Product Specifications

Product Name Alternative

CD27 antigen, CD27L receptor, T-cell activation antigen CD27, Tumor necrosis factor receptor superfamily member 7, CD_antigen= CD27

UniProt

P41272

Expression Region

24-250

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lauroylglycyrrhetinic acid
orb1696593-01 25 mg

Lauroylglycyrrhetinic acid

Sign In for Pricing
View Details
Lauroylglycyrrhetinic acid
orb1696593-02 50 mg

Lauroylglycyrrhetinic acid

Sign In for Pricing
View Details
Lauroylglycyrrhetinic acid
orb1696593-03 100 mg

Lauroylglycyrrhetinic acid

Sign In for Pricing
View Details
AmnioFroxx (type B) Complete Medium for amniotic fluid cells and chorion villi samples
2466ML500 500 mL

AmnioFroxx (type B) Complete Medium for amniotic fluid cells and chorion villi samples

Sign In for Pricing
View Details
Mouse Monoclonal RAB21 Antibody (OTI6E12) [DyLight 488]
NBP2-73769G 0.1 mL

Mouse Monoclonal RAB21 Antibody (OTI6E12) [DyLight 488]

Sign In for Pricing
View Details
Wnt-10a (A-4) : m-IgGκ BP-HRP Bundle
sc-522825 1 Kit

Wnt-10a (A-4) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details