Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD27 antigen (Cd27)

This Recombinant Mouse CD27 antigen (Cd27) spans the amino acid sequence from region 24-250.

Product Specifications

Product Name Alternative

CD27 antigen, CD27L receptor, T-cell activation antigen CD27, Tumor necrosis factor receptor superfamily member 7, CD_antigen= CD27

UniProt

P41272

Expression Region

24-250

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vacuolar Protein Sorting-Associated Protein 25 (VPS25) Antibody
abx239431 100 µg

Vacuolar Protein Sorting-Associated Protein 25 (VPS25) Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium smegmatis Probable malate:quinone oxidoreductase (mqo), partial
MBS1085450 Inquire

Recombinant Mycobacterium smegmatis Probable malate:quinone oxidoreductase (mqo), partial

Sign In for Pricing
View Details
12-Deoxyphorbol 13-palmitate
TN8147-01 10 mg

12-Deoxyphorbol 13-palmitate

Sign In for Pricing
View Details
12-Deoxyphorbol 13-palmitate
TN8147-02 50 mg

12-Deoxyphorbol 13-palmitate

Sign In for Pricing
View Details
3-Morpholino-N- (thiophen-2-ylmethyl) propan-1-amine
OR1037704-01 1 g

3-Morpholino-N- (thiophen-2-ylmethyl) propan-1-amine

Sign In for Pricing
View Details
3-Morpholino-N- (thiophen-2-ylmethyl) propan-1-amine
OR1037704-02 5 g

3-Morpholino-N- (thiophen-2-ylmethyl) propan-1-amine

Sign In for Pricing
View Details