Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitochondrial cardiolipin hydrolase (pld6)

This Recombinant Danio rerio Mitochondrial cardiolipin hydrolase (pld6) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Mitochondrial cardiolipin hydrolase, EC= 3.1.4.-, Choline phosphatase 6, Mitochondrial phospholipase, MitoPLD, Phosphatidylcholine-hydrolyzing phospholipase D6, Phospholipase D6, PLD 6

UniProt

A3KNW0

Expression Region

1-227

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVFKQMSFKELMKVLGLGTVAFVLGVEWLNWLTRRLRDSRGPLKEVLFFPSPQVCVEHLFTSHRSFPCACPFPHGIQTSFSRLLEHLLSARTSLEMCIFSFSNMEMSRAILLLHKRGVVVRVVTDRDYMTITGSQIGALRKAGISVRHEMSSAVHMHHKFALVDGRKLISGSLNWTLTAVQSNKENVIITEEPELVRPFQQEFLKLWEASDPANLKLQSKNGQIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details