Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor (TNF)

This Recombinant Macaca mulatta (Rhesus macaque) Tumor necrosis factor (TNF) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Tumor necrosis factor, Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2, TNF-a, Cleaved into the following 6 chains:, 1. Tumor necrosis factor, membrane form, N-terminal fragment, NTF, Intracellular domain 1, ICD1, Intracellular domain 2, ICD2, C-domain 1, C-domain 2, Tumor necrosis factor, soluble form

UniProt

P48094

Expression Region

1-233

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Cancer Biology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTESMIRDVELAEEALPRKTAGPQGSRRCWFLSLFSFLLVAGATTLFCLLHFGVIGPQREEFPKDPSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FOXP4 sgRNA gene knockout kit - Lentiviral human FOXP4 sgRNA gene knockout kit (plasmid)
GTR15378917 1 Vial

Lentiviral human FOXP4 sgRNA gene knockout kit - Lentiviral human FOXP4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MAFG Polyclonal Antibody
MBS9432832-01 0.05 mL

MAFG Polyclonal Antibody

Sign In for Pricing
View Details
MAFG Polyclonal Antibody
MBS9432832-02 0.1 mL

MAFG Polyclonal Antibody

Sign In for Pricing
View Details
MAFG Polyclonal Antibody
MBS9432832-03 5x 0.1 mL

MAFG Polyclonal Antibody

Sign In for Pricing
View Details
PSMA3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62092R-BF750-01 20 µL

PSMA3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PSMA3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-62092R-BF750-02 100 µL

PSMA3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details