What is the catalog number for Recombinant Sheep Kit ligand (KITLG)?

The catalog number for Recombinant Sheep Kit ligand (KITLG) is orb2902822.

What sizes are available for Recombinant Sheep Kit ligand (KITLG)?

Recombinant Sheep Kit ligand (KITLG) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Sheep Kit ligand (KITLG) come in?

Recombinant Sheep Kit ligand (KITLG) is available in 2 different pack sizes.

Is Recombinant Sheep Kit ligand (KITLG) in stock?

Recombinant Sheep Kit ligand (KITLG) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Sheep Kit ligand (KITLG)

This Recombinant Sheep Kit ligand (KITLG) spans the amino acid sequence from region 26-267.

Product Specifications

Product Name Alternative

Kit ligand, Mast cell growth factor, MGF, Stem cell factor, SCF, c-Kit ligand, Cleaved into the following chain:, 1. Soluble KIT ligand, 2. sKITLG

UniProt

P79368

Expression Region

26-267

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QGICRNRVTDDVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLL DKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSFENVKKSSKSPEPRQFTPEKFFGIFN KSIDAFKDLEIVASTMSECVISSTSSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKA SNSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKKKQPNLTRTVENRQINEEDNEISMLQ EK