Recombinant Rat Interleukin-2 receptor subunit alpha (Il2ra)
This Recombinant Rat Interleukin-2 receptor subunit alpha (Il2ra) spans the amino acid sequence from region 22-267.
Product Specifications
Product Name Alternative
Interleukin-2 receptor subunit alpha, IL-2 receptor subunit alpha, IL-2-RA, IL-2R subunit alpha, IL2-RA, CD_antigen= CD25
UniProt
P26897
Expression Region
22-267
Origin
Rattus norvegicus (Rat)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVASCIFLLLSILLLSGFTWQHRWRKSRRTI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-B684230-50MG 50 mg
2-Bromo-4-(ethoxycarbonylthio)-4-thiobenzoic Acid
Sign In for Pricing
View Details 
