Recombinant Chicken Integral membrane protein 2B (ITM2B)
This Recombinant Chicken Integral membrane protein 2B (ITM2B) spans the amino acid sequence from region 1-262.
Product Specifications
Product Name Alternative
Integral membrane protein 2B, Transmembrane protein E3-16
UniProt
O42204
Expression Region
1-262
Origin
Gallus gallus (Chicken)
Field of Research
Neuroscience; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVKVSFNSALAHKEAANKEEENSQVLILPPDAKEPEDVVVPAGHKRAWCWCMCFGLAFMLAGVILGGAYLYKYFAFQQGGVYFCGIKYIEDGLSLPESGAQLKSARYHTIEQNIQILEEEDVEFISVPVPEFADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAGTYLPQSYLIHEQMIVTDRIENVDQLGFFIYRLCRGKETYKLQRKEAMKGIQKREAVNCRKIRHFENRFAMETLICEQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
207937-HRP 100 µL
TRIM23 (Tripartite Motif-containing 23, ARD1, ARFD1, RNF46, ADP-ribosylation Factor Domain Protein 1, ADP-ribosylation Factor Domain Protein 1, 64kD, ARF Domain Protein 1, GTP-Binding Protein ARD-1, OTTHUMP00000123453, Tripartite Motif Protein TRIM23) (HRP)
Sign In for Pricing
View Details 
