Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Catechol O-methyltransferase (Comt)

This Recombinant Mouse Catechol O-methyltransferase (Comt) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Catechol O-methyltransferase, EC= 2.1.1.6

UniProt

O88587

Expression Region

1-265

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGPGSSPVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HXD13 Rabbit Polyclonal Antibody
MBS9514919-01 0.05 mL

HXD13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HXD13 Rabbit Polyclonal Antibody
MBS9514919-02 0.1 mL

HXD13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HXD13 Rabbit Polyclonal Antibody
MBS9514919-03 5x 0.1 mL

HXD13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CMAS Rabbit Polyclonal Antibody
orb1174274 100 µg

CMAS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDX59 (NM_001031725) Human Over-expression Lysate
LS083479 100 µg

DDX59 (NM_001031725) Human Over-expression Lysate

Sign In for Pricing
View Details
SEPT3 Protein Vector (Mouse) (pPM-C-HA)
PV227828 500 ng

SEPT3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details