Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Catechol O-methyltransferase (Comt)

This Recombinant Mouse Catechol O-methyltransferase (Comt) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Catechol O-methyltransferase, EC= 2.1.1.6

UniProt

O88587

Expression Region

1-265

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGPGSSPVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p53-S6 Rabbit pAb
MBS9143823-01 0.02 mL

Phospho-p53-S6 Rabbit pAb

Sign In for Pricing
View Details
Phospho-p53-S6 Rabbit pAb
MBS9143823-02 0.1 mL

Phospho-p53-S6 Rabbit pAb

Sign In for Pricing
View Details
Phospho-p53-S6 Rabbit pAb
MBS9143823-03 5x 0.1 mL

Phospho-p53-S6 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Salmonella muenchen Flagellar biosynthetic protein fliU (fliU)
MBS1003075-01 0.02 mg (E-Coli)

Recombinant Salmonella muenchen Flagellar biosynthetic protein fliU (fliU)

Sign In for Pricing
View Details
Recombinant Salmonella muenchen Flagellar biosynthetic protein fliU (fliU)
MBS1003075-02 0.1 mg (E-Coli)

Recombinant Salmonella muenchen Flagellar biosynthetic protein fliU (fliU)

Sign In for Pricing
View Details
Recombinant Salmonella muenchen Flagellar biosynthetic protein fliU (fliU)
MBS1003075-03 0.02 mg (Yeast)

Recombinant Salmonella muenchen Flagellar biosynthetic protein fliU (fliU)

Sign In for Pricing
View Details