Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Integral membrane protein 2B (Itm2b)

This Recombinant Mouse Integral membrane protein 2B (Itm2b) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Integral membrane protein 2B, Immature BRI2, imBRI2, Protein E25B, Transmembrane protein BRI, Bri, Cleaved into the following 4 chains:, 1. BRI2, membrane form, Mature BRI2, mBRI2, BRI2 intracellular domain, BRI2 ICD, BRI2C, soluble form, Bri23 peptide, Bri2-23, ABri23, C-terminal peptide, P23 peptide

UniProt

O89051

Expression Region

1-266

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKVTFNSALAQKEAKKDEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIKIFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNLLELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGIQKREASNCFTIRHFENKFAVETLICS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASIC1 Rabbit Polyclonal Antibody (APC)
orb2608663 100 µg

ASIC1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rabbit Anti-Human MIPP Polyclonal Antibody
PA86304HU-01 50 µg

Rabbit Anti-Human MIPP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human MIPP Polyclonal Antibody
PA86304HU-02 100 µg

Rabbit Anti-Human MIPP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human MIPP Polyclonal Antibody
PA86304HU-03 500 µg

Rabbit Anti-Human MIPP Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human MIPP Polyclonal Antibody
PA86304HU-04 1 mg

Rabbit Anti-Human MIPP Polyclonal Antibody

Sign In for Pricing
View Details
Wbp2nl 3'UTR Luciferase Stable Cell Line
TU223310 1.0 mL

Wbp2nl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details