What is the catalog number for Recombinant Rat Proline-rich protein 7 (Prr7)?

The catalog number for Recombinant Rat Proline-rich protein 7 (Prr7) is orb2902749.

What sizes are available for Recombinant Rat Proline-rich protein 7 (Prr7)?

Recombinant Rat Proline-rich protein 7 (Prr7) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Rat Proline-rich protein 7 (Prr7) come in?

Recombinant Rat Proline-rich protein 7 (Prr7) is available in 2 different pack sizes.

Is Recombinant Rat Proline-rich protein 7 (Prr7) in stock?

Recombinant Rat Proline-rich protein 7 (Prr7) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Rat Proline-rich protein 7 (Prr7)

This Recombinant Rat Proline-rich protein 7 (Prr7) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Proline-rich protein 7, Synaptic proline-rich membrane protein

UniProt

P0C6T3

Expression Region

1-269

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV