Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40)

This Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40) spans the amino acid sequence from region 20-289aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell surface antigen CD40; Bp50; CD40L receptor

UniProt

P27512

Expression Region

20-289aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GSTZ1 Antibody (03) [DyLight 755]
NBP3-06537IR 0.1 mL

Mouse Monoclonal GSTZ1 Antibody (03) [DyLight 755]

Sign In for Pricing
View Details
TB Solution IV
42020320-2 250 mL

TB Solution IV

Sign In for Pricing
View Details
PDZD9 Protein Vector (Human) (pPM-C-HA)
PV110356 500 ng

PDZD9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
GHRHR Antibody
CSB-PA009413LA01HU-01 50 µg

GHRHR Antibody

Sign In for Pricing
View Details
GHRHR Antibody
CSB-PA009413LA01HU-02 100 µg

GHRHR Antibody

Sign In for Pricing
View Details
KTAP2, CT (KRTCAP2, KCP2, Keratinocyte-associated protein 2) (Azide free) (HRP) discontinued
037650-HRP 200 µL

KTAP2, CT (KRTCAP2, KCP2, Keratinocyte-associated protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details