Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig TGF-beta receptor type-2 (TGFBR2)

This Recombinant Pig TGF-beta receptor type-2 (TGFBR2) spans the amino acid sequence from region 24-297.

Product Specifications

Product Name Alternative

TGF-beta receptor type-2, TGFR-2, EC= 2.7.11.30, TGF-beta type II receptor, Transforming growth factor-beta receptor type II, TGF-beta receptor type II, TbetaR-II

UniProt

P38551

Expression Region

24-297

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IPPHVPKSVNSDMMVTDSNGAVKLPQLCKFCDVRSSTCDNQKSCLSNCSITAICEKPQEV CVAVWRKNDENITIETVCDDPKIAYHGFVLDDAASSKCIMKERKGSGETFFMCSCSSDEC NDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIITFYCYRVHRQQKLSPSWDS GKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKL RQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oct-1 (POU2F1) (Center) Rabbit Polyclonal Antibody
AP53398PU-N 400 µL

Oct-1 (POU2F1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEF1B2 Human Gene Knockout Kit (CRISPR)
KN400733 1 Kit

EEF1B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS803180 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
CD45/PTPRC Monoclonal Antibody
AN200168P 100 µL

CD45/PTPRC Monoclonal Antibody

Sign In for Pricing
View Details
Etofenprox-phenol-d5
TRC-E936401-1MG 1 mg

Etofenprox-phenol-d5

Sign In for Pricing
View Details
RNF4 Mouse Monoclonal Antibody [Clone ID: OTI9F10]
CF811232 100 µg

RNF4 Mouse Monoclonal Antibody [Clone ID: OTI9F10]

Sign In for Pricing
View Details