Recombinant Mouse Tumor necrosis factor ligand superfamily member 6 (Faslg)

Tumor necrosis factor ligand superfamily member 6, CD95 ligand, CD95-L, Fas antigen ligand, Fas ligand, FasL, CD_antigen= CD178, Cleaved into the following 4 chains:, 1. Tumor necrosis factor ligand superfamily member 6, membrane form, 2. Tumor necrosis factor ligand superfamily member 6, soluble form, Receptor-binding FasL ectodomain, Soluble Fas ligand, sFasL, ADAM10-processed FasL form, APL, FasL intracellular domain, FasL ICD, SPPL2A-processed FasL form, SPA

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL