Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1 (CBR1)

This Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1 (CBR1) spans the amino acid sequence from region 1-285.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 1, EC= 1.6.2.2, Microsomal cytochrome b reductase

UniProt

A7TNL7

Expression Region

1-285

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESMNKIFIAIIAIAVAAAATKMFTSEEPKSKALPVLVKGEYMQFPLVSIKKLNRNSAIYRFKLPTDEHVLGLPIGQHITIKAHIDGSEVVRSYTPISLDSEAKGYFELLIKSYEQGKISKMFTSLKIGDTIDVQGPKGFYEYTDRSSKHLAMIAGGSGLTPMYQIIKSIAENPKDKTKVTFIYGNVEEIDILLRDDLDKFAASKPGQITIHYLLDKPSENWKGGSGYVTPELMKEKLPAPADGVQLLVCGPLPMVSAIKRSAVALGFPKAKPVSKMNDQVFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-500 1x 500 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-100 1x 100 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), CF405S conjugate, 0.1mg/mL
BNC040769-500 1x 500 µL

P27 / KIP1 (KIP1/769), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details