Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Syntaxin-1A (Stx1a)

This Recombinant Rat Syntaxin-1A (Stx1a) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Syntaxin-1A, Neuron-specific antigen HPC-1, Synaptotagmin-associated 35 kDa protein, P35A

UniProt

P32851

Expression Region

1-288

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SMC1B antibody
STJ114771 100 µl

Anti-SMC1B antibody

Sign In for Pricing
View Details
Ebribafusp Alfa Chimeric Monoclonal Antibody
orb2976149-01 100 µg

Ebribafusp Alfa Chimeric Monoclonal Antibody

Sign In for Pricing
View Details
Ebribafusp Alfa Chimeric Monoclonal Antibody
orb2976149-02 1 mg

Ebribafusp Alfa Chimeric Monoclonal Antibody

Sign In for Pricing
View Details
Olfr110 Mouse siRNA Oligo Duplex (Locus ID 258325)
SR410328 1 Kit

Olfr110 Mouse siRNA Oligo Duplex (Locus ID 258325)

Sign In for Pricing
View Details
Iron (II) chloride hydrate
sc-279221C 500 g

Iron (II) chloride hydrate

Sign In for Pricing
View Details
ADC siRNA (Mouse)
orb1835663-01 15 nmol

ADC siRNA (Mouse)

Sign In for Pricing
View Details