Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-1B (STX1B)

This Recombinant Human Syntaxin-1B (STX1B) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Syntaxin-1B, Syntaxin-1B1, Syntaxin-1B2

UniProt

P61266

Expression Region

1-288

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAGE Polyclonal Antibody
40667-01 50 µL

CAGE Polyclonal Antibody

Sign In for Pricing
View Details
CAGE Polyclonal Antibody
40667-02 100 µL

CAGE Polyclonal Antibody

Sign In for Pricing
View Details
RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (AP) discontinued
R1031-15A-AP 100 µL

RAGE (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (AP) discontinued

Sign In for Pricing
View Details
CRISP1 Rabbit Polyclonal Antibody
orb582134 100 µL

CRISP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (MaxLight 550)
MBS6211101-01 0.1 mL

DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (MaxLight 550)

Sign In for Pricing
View Details
DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (MaxLight 550)
MBS6211101-02 5x 0.1 mL

DDB2 (DNA Damage-binding Protein 2, DDB p48 Subunit, DDBb, Damage-specific DNA-binding Protein 2, UV-damaged DNA-binding Protein 2, UV-DDB 2) (MaxLight 550)

Sign In for Pricing
View Details