Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Syntaxin-1A (Stx1a)

This Recombinant Mouse Syntaxin-1A (Stx1a) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Syntaxin-1A, Neuron-specific antigen HPC-1

UniProt

O35526

Expression Region

1-288

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filamin A Rabbit pAb
A0927 200 µL

Filamin A Rabbit pAb

Sign In for Pricing
View Details
Recombinant Sex Determining Region Y Box Protein 11 (SOX11)
TRV-0044603-01 10 µg

Recombinant Sex Determining Region Y Box Protein 11 (SOX11)

Sign In for Pricing
View Details
Recombinant Sex Determining Region Y Box Protein 11 (SOX11)
TRV-0044603-02 50 µg

Recombinant Sex Determining Region Y Box Protein 11 (SOX11)

Sign In for Pricing
View Details
Recombinant Sex Determining Region Y Box Protein 11 (SOX11)
TRV-0044603-03 100 µg

Recombinant Sex Determining Region Y Box Protein 11 (SOX11)

Sign In for Pricing
View Details
Recombinant Sex Determining Region Y Box Protein 11 (SOX11)
TRV-0044603-04 200 µg

Recombinant Sex Determining Region Y Box Protein 11 (SOX11)

Sign In for Pricing
View Details
Recombinant Sex Determining Region Y Box Protein 11 (SOX11)
TRV-0044603-05 500 µg

Recombinant Sex Determining Region Y Box Protein 11 (SOX11)

Sign In for Pricing
View Details