Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Syntaxin-2 (Stx2)

This Recombinant Rat Syntaxin-2 (Stx2) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Syntaxin-2, Epimorphin

UniProt

P50279

Expression Region

1-290

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRDRLPDLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKKWIIAAVVVAVIAVLALIIGLTVGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)
MBS1294375-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)
MBS1294375-02 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)
MBS1294375-03 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)
MBS1294375-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)
MBS1294375-05 0.02 mg (Baculovirus)

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)
MBS1294375-06 0.02 mg (Mammalian-Cell)

Recombinant Dictyostelium discoideum V-type proton ATPase subunit H (vatH)

Sign In for Pricing
View Details